Cusabio Human Recombinants
Recombinant Human Fibroleukin (FGL2) | CSB-YP619871HU
- SKU:
- CSB-YP619871HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human Fibroleukin (FGL2) | CSB-YP619871HU | Cusabio
Alternative Name(s): Fibrinogen-like protein 2 pT49
Gene Names: FGL2
Research Areas: Immunology
Organism: Homo sapiens (Human)
AA Sequence: NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 24-439aa
Sequence Info: Full Length of Mature Protein
MW: 49.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May play a role in physiologic lymphocyte functions at mucosal sites
Reference: "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May play a role in physiologic lymphocyte functions at mucosal sites.
Involvement in disease:
Subcellular Location: Secreted
Protein Families:
Tissue Specificity: Constitutively expressed in cytotoxic T-cells.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q14314
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM