Recombinant Human Fibroblast growth factor 5 protein (FGF5) | CSB-RP095144h

(No reviews yet) Write a Review
SKU:
CSB-RP095144h
Availability:
13 - 23 Working Days
  • Recombinant Human Fibroblast growth factor 5 protein (FGF5)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Fibroblast growth factor 5 protein (FGF5) | CSB-RP095144h | Cusabio

Alternative Name(s): Heparin-binding growth factor 5 ;HBGF-5Smag-82

Gene Names: FGF5 5

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 18-268aa

Sequence Info: Full Length of Mature Protein

MW: 54.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase .

Reference: Expression of the murine fibroblast growth factor 5 gene in the adult central nervous system.Haub O., Drucker B., Goldfarb M.Proc. Natl. Acad. Sci. U.S.A. 87:8022-8026(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase (By similarity).

Involvement in disease: Trichomegaly (TCMGLY)

Subcellular Location: Secreted

Protein Families: Heparin-binding growth factors family

Tissue Specificity: Expressed in neonatal brain.

Paythway: MAPKsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12034

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose