Cusabio Human Recombinants
Recombinant Human Fibroblast growth factor 18 (FGF18) | CSB-EP008623HU
- SKU:
- CSB-EP008623HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Fibroblast growth factor 18 (FGF18) | CSB-EP008623HU | Cusabio
Alternative Name(s): zFGF5
Gene Names: FGF18
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 28-207aa
Sequence Info: Full Length of Mature Protein
MW: 25.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.
Reference: "FGF-18, a novel member of the fibroblast growth factor family, stimulates hepatic and intestinal proliferation." Hu M.C.-T., Qiu W.R., Wang Y.-P., Hill D., Ring B.D., Scully S., Bolon B., Derose M., Luethy R., Simonet W.S., Arakawa T., Danilenko D.M. Mol. Cell. Biol. 18:6063-6074(1998)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O76093
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A
 
             
             
                         
                         
             
             
             
            