Recombinant Human Embryonic stem cell-related gene protein (HESRG) | CSB-EP632275HU

Recombinant Human Embryonic stem cell-related gene protein (HESRG) | CSB-EP632275HU | Cusabio

Alternative Name(s): ESRG; HESRG; Embryonic stem cell-related gene protein; hES cell-related gene protein

Gene Names: ESRG

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSVRKIHLRPQVLRPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNFNSFHSLVETKETCFIREPKTPAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPLAASPAFLGQGQVPLNPFSFTLSGKSRFSGAGASTPQPLLLHP

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-222aa

Sequence Info: Full Length

MW: 28.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Identification, expression and subcellular localization of ESRG.Li G., Ren C., Shi J., Huang W., Liu H., Feng X., Liu W., Zhu B., Zhang C., Wang L., Yao K., Jiang X.Biochem. Biophys. Res. Commun. 435:160-164(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Nucleus

Protein Families:

Tissue Specificity: Expressed only in fetal ovary and in undifferentiated ES cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q1W209

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: OMIM