Recombinant Human Elongation factor 1-beta (EEF1B2) | CSB-EP335050HU

Recombinant Human Elongation factor 1-beta (EEF1B2) | CSB-EP335050HU | Cusabio

Alternative Name(s): EEF1B; EEF1B1; EEF1B2; EF-1-beta; EF1B; EF1B_HUMAN; Elongation factor 1; beta-2-A; Elongation factor 1-beta; eukaryotic translation elongation factor 1 beta 1; eukaryotic translation elongation factor 1 beta 2

Gene Names: EEF1B2

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: GFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-225aa

Sequence Info: Full Length

MW: 51.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.

Reference: "Human elongation factor 1 beta: cDNA and derived amino acid sequence." von der Kammer H., Klaudiny J., Zimmer M., Scheit K.H. Biochem. Biophys. Res. Commun. 177:312-317(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.

Involvement in disease:

Subcellular Location:

Protein Families: EF-1-beta/EF-1-delta family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P24534

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM