Recombinant Human Early growth response protein 1 (EGR1), partial | CSB-YP007484HU

Recombinant Human Early growth response protein 1 (EGR1), partial | CSB-YP007484HU | Cusabio

Alternative Name(s): AT225Nerve growth factor-induced protein A ;NGFI-ATranscription factor ETR103Transcription factor Zif268Zinc finger protein 225Zinc finger protein Krox-24

Gene Names: EGR1

Research Areas: Transcription

Organism: Homo sapiens (Human)

AA Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 444-543aa

Sequence Info: Partial

MW: 12.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.

Reference: cDNA sequence of the human cellular early growth response gene Egr-1.Suggs S.V., Katzowitz J.L., Tsai-Morris C.-H., Sukhatme V.P.Nucleic Acids Res. 18:4283-4283(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transcriptional regulator

Involvement in disease:

Subcellular Location: Nucleus, Cytoplasm

Protein Families: EGR C2H2-type zinc-finger protein family

Tissue Specificity: Detected in neutrophils (at protein level).

Paythway: AGE-RAGEsignalingpathwayindiabeticcomplications

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P18146

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM