Recombinant Human Dynein light chain 1, Cytoplasmic domain (DYNLL1) | CSB-RP012844h

(No reviews yet) Write a Review
SKU:
CSB-RP012844h
Availability:
3 - 7 Working Days
  • Recombinant Human Dynein light chain 1, Cytoplasmic domain (DYNLL1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Dynein light chain 1, Cytoplasmic domain (DYNLL1) | CSB-RP012844h | Cusabio

Alternative Name(s): 8KDA dynein light chain ;DLC8Dynein light chain LC8-type 1;Protein inhibitor of neuronal nitric oxide synthase ;PIN

Gene Names: DYNLL1

Research Areas: Apoptosis

Organism: Homo sapiens (Human)

AA Sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-89aa

Sequence Info: Full Length

MW: 37.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts as one of several non-catalytic accessory components of the Cytoplasmic domain dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic domain dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from Cytoplasmic domain dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.

Reference: Biochemical and structural characterization of the Pak1-LC8 interaction.Lightcap C.M., Sun S., Lear J.D., Rodeck U., Polenova T., Williams J.C.J. Biol. Chem. 283:27314-27324(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.; FUNCTION

Involvement in disease:

Subcellular Location: Cytoplasm, cytoskeleton, Nucleus, Mitochondrion

Protein Families: Dynein light chain family

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P63167

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose