Cusabio Human Recombinants
Recombinant Human Dual specificity protein phosphatase 26 (DUSP26) | CSB-EP863128HU
- SKU:
- CSB-EP863128HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Dual specificity protein phosphatase 26 (DUSP26) | CSB-EP863128HU | Cusabio
Alternative Name(s): Dual specificity phosphatase SKRP3Low-molecular-mass dual-specificity phosphatase 4 ;DSP-4 ;LDP-4Mitogen-activated protein kinase phosphatase 8 ;MAP kinase phosphatase 8 ;MKP-8Novel amplified gene in thyroid anaplastic cancer
Gene Names: DUSP26
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-211aa
Sequence Info: Full Length
MW: 39.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
Reference: MKP-8, a novel MAPK phosphatase that inhibits p38 kinase.Vasudevan S.A., Skoko J., Wang K., Burlingame S.M., Patel P.N., Lazo J.S., Nuchtern J.G., Yang J.Biochem. Biophys. Res. Commun. 330:511-518(2005)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
Involvement in disease:
Subcellular Location: Cytoplasm, Nucleus, Golgi apparatus
Protein Families: Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Tissue Specificity: Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9BV47
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A