Recombinant Human Deoxyribonuclease gamma (DNASE1L3) | CSB-EP621686HU

Recombinant Human Deoxyribonuclease gamma (DNASE1L3) | CSB-EP621686HU | Cusabio

Alternative Name(s): DNase I homolog protein DHP2 Deoxyribonuclease I-like 3 Short name: DNase I-like 3 Liver and spleen DNase Short name: LS-DNase Short name: LSD

Gene Names: DNASE1L3

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 21-305aa

Sequence Info: Full Length of Mature Protein

MW: 60.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal units.

Reference: "Identification, localization, and expression of two novel human genes similar to deoxyribonuclease I."Rodriguez A.M., Rodin D., Nomura H., Morton C.C., Weremowicz S., Schneider M.C.Genomics 42:507-513(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends (By similarity). Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA

Involvement in disease: Systemic lupus erythematosus 16 (SLEB16)

Subcellular Location: Nucleus, Endoplasmic reticulum, Secreted

Protein Families: DNase I family

Tissue Specificity: Liver and spleen.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q13609

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM