Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial | CSB-EP618924HIV

(No reviews yet) Write a Review
SKU:
CSB-EP618924HIV
Availability:
3 - 7 Working Days
  • Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial | CSB-EP618924HIV | Cusabio

Target Name: S

Uniprot No: Q14EB0

Species: Human coronavirus HKU1 (isolate N2) (HCoV-HKU1)

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 310-622aa

Sequence Description: Partial

Target Protein Sequence: TVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNVSSYDVVYSDHCFSVNSDFCPCADPSVVNSCVKSKPLSAICPAGTKYRHCDLDTTLYVNNWCRCSCLPDPISTYSPNTCPQKKVVVGIGEHCPGLGINEEKCGTQLNHSSCSCSPDAFLGWSFDSCISNNRCNIFSNFIFNGINSGTTCSNDLLYSNTEVSTGVCVNY

Mol. Weight: 35.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

View AllClose

0 Reviews

View AllClose