Recombinant Human coronavirus 229E Nucleoprotein (N) | CSB-BP322753HIT

(No reviews yet) Write a Review
SKU:
CSB-BP322753HIT
Availability:
3 - 7 Working Days
  • Recombinant Human coronavirus 229E Nucleoprotein (N)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€306.00 - €676.00

Description

Recombinant Human coronavirus 229E Nucleoprotein (N) | CSB-BP322753HIT | Cusabio

Target Name: N

Uniprot No: P15130

Species: Human coronavirus 229E (HCoV-229E)

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-389aa

Sequence Description: Full Length

Target Protein Sequence: MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN

Mol. Weight: 47.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Lyophilized powder

Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

View AllClose

0 Reviews

View AllClose