Cusabio Human Recombinants
Recombinant Human Chorionic somatomammotropin hormone protein (CSH1) | CSB-EP006053HU
- SKU:
- CSB-EP006053HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Chorionic somatomammotropin hormone protein (CSH1) | CSB-EP006053HU | Cusabio
Alternative Name(s): Lactogen Placental lactogen Short name: PL
Gene Names: CSH1
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 27-217aa
Sequence Info: Full Length of Mature Protein
MW: 26.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
Reference: "The human growth hormone locus: nucleotide sequence, biology, and evolution."Chen E.Y., Liao Y.C., Smith D.H., Barrera-Saldana H.A., Gelinas R.E., Seeburg P.H.Genomics 4:479-497(1989)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Somatotropin/prolactin family
Tissue Specificity:
Paythway: Jak-STATsignalingpathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P0DML2
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM