Recombinant Human Chorionic somatomammotropin hormone protein (CSH1) | CSB-EP006053HU

(No reviews yet) Write a Review
SKU:
CSB-EP006053HU
Availability:
3 - 7 Working Days
€245.00 - €1,277.00

Description

Recombinant Human Chorionic somatomammotropin hormone protein (CSH1) | CSB-EP006053HU | Cusabio

Alternative Name(s): Lactogen Placental lactogen Short name: PL

Gene Names: CSH1

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 27-217aa

Sequence Info: Full Length of Mature Protein

MW: 26.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.

Reference: "The human growth hormone locus: nucleotide sequence, biology, and evolution."Chen E.Y., Liao Y.C., Smith D.H., Barrera-Saldana H.A., Gelinas R.E., Seeburg P.H.Genomics 4:479-497(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Somatotropin/prolactin family

Tissue Specificity:

Paythway: Jak-STATsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0DML2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose