Cusabio Human Recombinants
Recombinant Human Chloride intracellular channel protein 4 (CLIC4) | CSB-EP005549HU
- SKU:
- CSB-EP005549HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Chloride intracellular channel protein 4 (CLIC4) | CSB-EP005549HU | Cusabio
Alternative Name(s): Intracellular chloride ion channel protein p64H1
Gene Names: CLIC4
Research Areas: Cell Biology
Organism: Homo sapiens (Human)
AA Sequence: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-253aa
Sequence Info: Full Length
MW: 55.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Promotes cell-surface expression of HRH3. Has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis. Could also promote endothelial cell proliferation and regulate endothelial morphogenesis (tubulogenesis).
Reference: "A novel p64-related Cl- channel: subcellular distribution and nephron segment-specific expression." Edwards J.C. Am. J. Physiol. 276:F398-F408(1999)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Promotes cell-surface expression of HRH3. Has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis. Could also promote endothelial cell proliferation and regulate endothelial morphogenesis (tubulogenesis).
Involvement in disease:
Subcellular Location: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasmic vesicle membrane, Single-pass membrane protein, Nucleus matrix, Cell membrane, Single-pass membrane protein, Mitochondrion, Cell junction
Protein Families: Chloride channel CLIC family
Tissue Specificity: Detected in epithelial cells from colon, esophagus and kidney (at protein level). Expression is prominent in heart, kidney, placenta and skeletal muscle.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9Y696
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM