Recombinant Human Cellular retinoic acid-binding protein 1 (CRABP1) | CSB-EP005935HU

Recombinant Human Cellular retinoic acid-binding protein 1 (CRABP1) | CSB-EP005935HU | Cusabio

Alternative Name(s): Cellular retinoic acid-binding protein I ;CRABP-I

Gene Names: CRABP1

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-137aa

Sequence Info: Full Length of Mature Protein

MW: 42.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.

Reference: Structures of cellular retinoic acid binding proteins I and II in complex with synthetic retinoids.Chaudhuri B.N., Kleywegt G.J., Broutin-L'Hermite I., Bergfors T., Senn H., Le Motte P., Partouche O., Jones T.A.Acta Crystallogr. D 55:1850-1857(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Calycin superfamily, Fatty-acid binding protein (FABP) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P29762

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM