Recombinant Human CD320 antigen (CD320) , partial | CSB-RP106044h

(No reviews yet) Write a Review
SKU:
CSB-RP106044h
Availability:
13 - 23 Working Days
  • Recombinant Human CD320 antigen (CD320) , partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human CD320 antigen (CD320) , partial | CSB-RP106044h | Cusabio

Alternative Name(s): 8D6 antigenFDC-signaling molecule 8D6 ;FDC-SM-8D6Transcobalamin receptor ;TCblR;; CD320

Gene Names: CD320

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 36-231aa

Sequence Info: Partial

MW: 47.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.

Reference: Identification of a human follicular dendritic cell molecule that stimulates germinal center B cell growth.Li L., Zhang X., Kovacic S., Long A.J., Bourque K., Wood C.R., Choi Y.S.J. Exp. Med. 191:1077-1084(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for transcobalamin saturated with cobalamin (TCbl)

Involvement in disease: Methylmalonic aciduria, transient, due to transcobalamin receptor defect (MMATC)

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Detected in the germinal center (GC) of lymphoid follicles (at protein level) (PubMed:11418631). Expressed abundantly on follicular dendritic cells (FDCs) (PubMed:10727470).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NPF0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose