Recombinant Human Cathepsin O (CTSO) | CSB-MP006203HU

(No reviews yet) Write a Review
SKU:
CSB-MP006203HU
Availability:
18 - 28 Working Days
  • Recombinant Human Cathepsin O (CTSO)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€529.00 - €1,301.00

Description

Recombinant Human Cathepsin O (CTSO) | CSB-MP006203HU | Cusabio

Alternative Name(s): CTSO1

Gene Names: CTSO

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 108-321aa

Sequence Info: Full Length of Mature Protein

MW: 28.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Reference: "First genome-wide association scan on neurophysiological endophenotypes points to trans-regulation effects on SLC2A3 in dyslexic children." Roeske D., Ludwig K.U., Neuhoff N., Becker J., Bartling J., Bruder J., Brockschmidt F.F., Warnke A., Remschmidt H., Hoffmann P., Muller-Myhsok B., Nothen M.M., Schulte-Korne G. Mol. Psychiatry 16:97-107(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Involvement in disease:

Subcellular Location: Lysosome

Protein Families: Peptidase C1 family

Tissue Specificity: Expressed in all tissues examined. High levels seen in the ovary, kidney and placenta while low levels seen in thymus and skeletal muscle.

Paythway: Apoptosis

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P43234

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose