Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7) | CSB-EP005167HU

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7) | CSB-EP005167HU | Cusabio

Alternative Name(s): Carcinoembryonic antigen CGM2

Gene Names: CEACAM7

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 36-242aa

Sequence Info: Full Length of Mature Protein

MW: 39.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "CGM2, a member of the carcinoembryonic antigen gene family is down-regulated in colorectal carcinomas."Thompson J., Zimmermann W., Nollau P., Neumaier M., Weber-Arden J., Schrewe H., Craig I., Willcocks T.J. Biol. Chem. 269:32924-32931(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families: Immunoglobulin superfamily, CEA family

Tissue Specificity: Strongly down-regulated in colonic adenocarcinomas.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q14002

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A