Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial | CSB-YP005164HU

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial | CSB-YP005164HU | Cusabio

Alternative Name(s): Carcinoembryonic antigen CGM7Non-specific cross-reacting antigen W236

Gene Names: CEACAM4

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 36-155aa

Sequence Info: Partial

MW: 14.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

Reference: Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y.J. Biol. Chem. 266:11810-11817(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: Immunoglobulin superfamily, CEA family

Tissue Specificity: Granulocytes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O75871

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A