Recombinant Human Carboxypeptidase D (CPD), partial | CSB-MP005885HU1

Recombinant Human Carboxypeptidase D (CPD), partial | CSB-MP005885HU1 | Cusabio

Alternative Name(s): Metallocarboxypeptidase D gp180

Gene Names: CPD

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP

Source: Mammalian cell

Tag Info: C-terminal hFc-Myc-tagged

Expression Region: 383-461aa

Sequence Info: Partial

MW: 37.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalytic activity Releases C-terminal Arg and Lys from polypeptides. EC:3.4.17.22

Reference: "Sequence of human carboxypeptidase D reveals it to be a member of the regulatory carboxypeptidase family with three tandem active site domains." Tan F., Rehli M., Krause S.W., Skidgel R.A. Biochem. J. 327:81-87(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O75976

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A