Recombinant Human Carbamoyl-phosphate synthase [ammonia], mitochondrial (CPS1), partial | CSB-EP005913HU

Recombinant Human Carbamoyl-phosphate synthase [ammonia], mitochondrial (CPS1), partial | CSB-EP005913HU | Cusabio

Alternative Name(s): Carbamoyl-phosphate synthetase I (CPSase I)

Gene Names: CPS1

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: GFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1354-1500aa

Sequence Info: Partial

MW: 20.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the urea cycle of ureotelic animals where the enzyme plays an important role in removing excess ammonia from the cell.

Reference: "Cloning and sequence of a cDNA encoding human carbamyl phosphate synthetase I: molecular analysis of hyperammonemia." Haraguchi Y., Uchino T., Takiguchi M., Endo F., Mori M., Matsuda I. Gene 107:335-340(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31327

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A