Recombinant Human Cancer/testis antigen 1 (CTAG1A) | CSB-YP006125HU

Recombinant Human Cancer/testis antigen 1 (CTAG1A) | CSB-YP006125HU | Cusabio

Alternative Name(s): Autoimmunogenic cancer/testis antigen NY-ESO-1Cancer/testis antigen 6.1 ;CT6.1L antigen family member 2 ;LAGE-2

Gene Names: CTAG1A

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-180aa

Sequence Info: Full Length

MW: 20 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening.Chen Y.-T., Scanlan M.J., Sahin U., Tuereci O., Gure A.O., Tsang S., Williamson B., Stockert E., Pfreundschuh M., Old L.J.Proc. Natl. Acad. Sci. U.S.A. 94:1914-1918(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: CTAG/PCC1 family

Tissue Specificity: Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P78358

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM