Recombinant Human C-X-C motif chemokine 5 (CXCL5), partial | CSB-EP006250HU1

Recombinant Human C-X-C motif chemokine 5 (CXCL5), partial | CSB-EP006250HU1 | Cusabio

Alternative Name(s): ENA-78(1-78)Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5

Gene Names: CXCL5

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 37-110aa

Sequence Info: Partial

MW: 11.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chotactic activity for neutrophil granulocytes.

Reference: Regulation of the immune response by the interaction of chemokines and proteases.Struyf S., Proost P., Van Damme J.Adv. Immunol. 81:1-44(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway: Chemokinesignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P42830

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM