Recombinant Human C-Myc-binding protein (MYCBP) | CSB-EP858710HU

Recombinant Human C-Myc-binding protein (MYCBP) | CSB-EP858710HU | Cusabio

Alternative Name(s): Associate of Myc 1 ;AMY-1

Gene Names: MYCBP

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: AHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-103aa

Sequence Info: Full Length of Mature Protein

MW: 27.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.

Reference: AMY-1, a novel C-MYC binding protein that stimulates transcription activity of C-MYC.Taira T., Maeda J., Ohishi T., Kitaura H., Yoshida S., Kato H., Ikeda M., Tamai K., Iguchi-Ariga S.M.M., Ariga H.Genes Cells 3:549-565(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus, Mitochondrion

Protein Families: AMY1 family

Tissue Specificity: Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99417

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM