Recombinant Human C-C motif chemokine 8 (CCL8) | CSB-YP004802HU

Recombinant Human C-C motif chemokine 8 (CCL8) | CSB-YP004802HU | Cusabio

Alternative Name(s): HC14Monocyte chemoattractant protein 2Monocyte chemotactic protein 2 ;MCP-2Small-inducible cytokine A8

Gene Names: CCL8

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-99aa

Sequence Info: Full Length of Mature Protein

MW: 10.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Chotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chotactic activity, but inhibits the chotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.

Reference: Complete crystal structure of monocyte chemotactic protein-2, a CC chemokine that interacts with multiple receptors.Blaszczyk J., Coillie E.V., Proost P., Damme J.V., Opdenakker G., Bujacz G.D., Wang J.M., Ji X.Biochemistry 39:14075-14081(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine beta (chemokine CC) family

Tissue Specificity: Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate.

Paythway: Chemokinesignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P80075

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM