Recombinant Human C-C chemokine receptor type 8 (CCR8), partial, Nanodiscs | CSB-CF004847HU2-N

(No reviews yet) Write a Review
SKU:
CSB-CF004847HU2-N
Availability:
18 - 23 Working Days
  • Recombinant Human C-C chemokine receptor type 8 (CCR8), partial, Nanodiscs
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€774.00 - €1,032.00

Description

Recombinant Human C-C chemokine receptor type 8 (CCR8), partial, Nanodiscs | CSB-CF004847HU2-N | Cusabio

Alternative Name(s): CC chemokine receptor CHEMR1;CMKBRL2Chemokine receptor-like 1;CKR-L1;GPR-CY6;GPRCY6;TER1;CDw198

Gene Names: CCR8

Research Areas: G-protein coupled receptor, Receptor, Transducer

Organism: Homo sapiens (Human)

AA Sequence: LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 74-129aa

Sequence Info: Partial

MW: 9.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.

Reference: "The assignment of chemokine-chemokine receptor pairs: TARC and MIP-1 beta are not ligands for human CC-chemokine receptor 8." Garlisi C.G., Xiao H., Tian F., Hedrick J.A., Billah M.M., Egan R.W., Umland S.P. Eur. J. Immunol. 29:3210-3215(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P51685

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose