Recombinant Human BPI fold-containing family A member 2 (BPIFA2) | CSB-YP839308HU

Recombinant Human BPI fold-containing family A member 2 (BPIFA2) | CSB-YP839308HU | Cusabio

Alternative Name(s): Parotid secretory protein

Gene Names: BPIFA2

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

Expression Region: 19-249aa

Sequence Info: Full Length of Mature Protein

MW: 41.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has strong antibacterial activity against P. aeruginosa.

Reference: "Human parotid secretory protein is a lipopolysaccharide-binding protein: identification of an anti-inflammatory peptide domain." Abdolhosseini M., Sotsky J.B., Shelar A.P., Joyce P.B., Gorr S.U. Mol. Cell. Biochem. 359:1-8(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has strong antibacterial activity against P. aeruginosa.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: BPI/LBP/Plunc superfamily, Plunc family

Tissue Specificity: Detected in submandibular gland. Secreted into saliva.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96DR5

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A