Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2) (Active) | CSB-EP896544HU

Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2) (Active) | CSB-EP896544HU | Cusabio

Protein Description: Full Length

Alternative Name (s) :

Gene Names: BZW2

Research Areas: Cell Biology

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-419aa

Sequence Info: MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 μg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 μg/ml.

MW: 75.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Relevance: May be involved in neuronal differentiation.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Y6E2

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A