Recombinant Human AP-1 complex subunit sigma-3 (AP1S3) | CSB-EP001868HU

Recombinant Human AP-1 complex subunit sigma-3 (AP1S3) | CSB-EP001868HU | Cusabio

Alternative Name(s): Adaptor protein complex AP-1 subunit sigma-1C;Adaptor-related protein complex 1 subunit sigma-1C;Clathrin assembly protein complex 1 sigma-1C small chain;Golgi adaptor HA1/AP1 adaptin sigma-1C subunit;Sigma 1C subunit of AP-1 clathrin;Sigma-adaptin 1C;Sigma1C-adaptin

Gene Names: AP1S3

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-104aa

Sequence Info: Full Length of Isoform 3

MW: 39.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to mbranes and the recognition of sorting signals within the cytosolic tails of transmbrane cargo molecules. Involved in TLR3 trafficking .

Reference: AP1S3 mutations are associated with pustular psoriasis and impaired Toll-like receptor 3 trafficking.Setta-Kaffetzi N., Simpson M.A., Navarini A.A., Patel V.M., Lu H.C., Allen M.H., Duckworth M., Bachelez H., Burden A.D., Choon S.E., Griffiths C.E., Kirby B., Kolios A., Seyger M.M., Prins C., Smahi A., Trembath R.C., Fraternali F. , Smith C.H., Barker J.N., Capon F.Am. J. Hum. Genet. 94:790-797(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking

Involvement in disease: Psoriasis 15, pustular (PSORS15)

Subcellular Location: Golgi apparatus, Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, clathrin-coated pit

Protein Families: Adaptor complexes small subunit family

Tissue Specificity: Widely expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96PC3

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM