Cusabio Human Recombinants
Recombinant Human Angiopoietin-like protein 8 (ANGPTL8) | CSB-BP757793HU
- SKU:
- CSB-BP757793HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Angiopoietin-like protein 8 (ANGPTL8) | CSB-BP757793HU | Cusabio
Alternative Name(s): Betatrophin (Lipasin) (Refeeding-induced fat and liver protein) (C19orf80) (RIFL)
Gene Names: ANGPTL8
Research Areas: Cell Biology
Organism: Homo sapiens (Human)
AA Sequence: APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged
Expression Region: 22-198aa
Sequence Info: Full Length of Mature Protein
MW: 22.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels. May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state.
Reference: "Lipasin, a novel nutritionally-regulated liver-enriched factor that regulates serum triglyceride levels." Zhang R. Biochem. Biophys. Res. Commun. 424:786-792(2012)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q6UXH0
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A