Cusabio Human Recombinants
Recombinant Human Alpha-hemoglobin-stabilizing protein (AHSP) | CSB-EP878935HU
- SKU:
 - CSB-EP878935HU
 - Availability:
 - 13 - 23 Working Days
 
Description
Recombinant Human Alpha-hemoglobin-stabilizing protein (AHSP) | CSB-EP878935HU | Cusabio
Alternative Name(s): Erythroid differentiation-related factor Erythroid-associated factor
Gene Names: AHSP
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-102aa
Sequence Info: Full Length
MW: 38.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia.
Reference: "A novel erythroid-specific marker of transmissible spongiform encephalopathies." Miele G., Manson J., Clinton M. Nat. Med. 7:361-364(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: AHSP family
Tissue Specificity: Expressed in blood and bone marrow.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9NZD4
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM