Recombinant Human ADP-ribosylation factor 5 (ARF5) | CSB-RP009054h

Recombinant Human ADP-ribosylation factor 5 (ARF5) | CSB-RP009054h | Cusabio

Alternative Name(s): ADP ribosylation factor 5; ADP-ribosylation factor 5; ARF 5; Arf5; ARF5_HUMAN

Gene Names: ARF5

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: GLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-180aa

Sequence Info: Full Length of Mature Protein

MW: 47.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Reference: Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells.Tsuchiya M., Price S.R., Tsai S.-C., Moss J., Vaughan M.J. Biol. Chem. 266:2772-2777(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Involvement in disease:

Subcellular Location: Golgi apparatus, Cytoplasm, perinuclear region, Membrane, Lipid-anchor

Protein Families: Small GTPase superfamily, Arf family

Tissue Specificity:

Paythway: Endocytosis

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P84085

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM