Recombinant Human Acidic fibroblast growth factor intracellular-binding protein (FIBP) | CSB-EP008671HU

Recombinant Human Acidic fibroblast growth factor intracellular-binding protein (FIBP) | CSB-EP008671HU | Cusabio

Alternative Name(s): FGF-1 intracellular-binding protein

Gene Names: FIBP

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-357aa

Sequence Info: Full Length of Isoform Short

MW: 57.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in mitogenic function of FGF1.

Reference: Cloning of an intracellular protein that binds selectively to mitogenic acidic fibroblast growth factor.Kolpakova E., Wiedlocha A., Stenmark H., Klingenberg O., Falnes P.O., Olsnes S.Biochem. J. 336:213-222(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in mitogenic function of FGF1. May mediate with IER2 FGF-signaling in the establishment of laterality in the embryo (By similarity).

Involvement in disease: Thauvin-Robinet-Faivre syndrome (TROFAS)

Subcellular Location: Nucleus, Endomembrane system, Peripheral membrane protein

Protein Families:

Tissue Specificity: Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43427

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM