Recombinant Human 60S ribosomal protein L10a (RPL10A), partial | CSB-RP052444h

Recombinant Human 60S ribosomal protein L10a (RPL10A), partial | CSB-RP052444h | Cusabio

Alternative Name(s): CSA-19Neural precursor cell expressed developmentally down-regulated protein 6 ;NEDD-6

Gene Names: RPL10A

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQR

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 4-215aa

Sequence Info: Partial

MW: 51.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Identification of genes downregulated in the thymus by cyclosporin-A preliminary characterization of clone CSA-19.Fisicaro N., Katerelos M., Williams J., Power D., D'Apice A., Pearse M.Mol. Immunol. 32:565-572(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Component of the large ribosomal subunit.

Involvement in disease:

Subcellular Location:

Protein Families: Universal ribosomal protein uL1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P62906

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM