Recombinant Human 60S acidic ribosomal protein P2 (RPLP2) | CSB-EP020342HU

Recombinant Human 60S acidic ribosomal protein P2 (RPLP2) | CSB-EP020342HU | Cusabio

Alternative Name(s): Large ribosomal subunit protein P2 Renal carcinoma antigen NY-REN-44 D11S2243E, RPP2

Gene Names: RPLP2

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-115aa

Sequence Info: Full Length

MW: 15.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays an important role in the elongation step of protein synthesis.

Reference: "Human acidic ribosomal phosphoproteins P0, P1, and P2: analysis of cDNA clones, in vitro synthesis, and assembly." Rich B.E., Steitz J.A. Mol. Cell. Biol. 7:4065-4074(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays an important role in the elongation step of protein synthesis.

Involvement in disease:

Subcellular Location:

Protein Families: Eukaryotic ribosomal protein P1/P2 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05387

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM