Recombinant Hirudo nipponia Guamerin | CSB-YP342406HHK

Recombinant Hirudo nipponia Guamerin | CSB-YP342406HHK | Cusabio

Alternative Name(s): Guamerin

Gene Names: N/A

Research Areas: Others

Organism: Hirudo nipponia (Korean blood-sucking leech)

AA Sequence: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-57aa

Sequence Info: Full Length

MW: 8.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Inhibits mammalian elastases.

Reference: "Isolation and characterization of guamerin, a new human leukocyte elastase inhibitor from Hirudo nipponia."Jung H.I., Kim S.I., Ha K.-S., Joe C.O., Kang K.W.J. Biol. Chem. 270:13879-13884(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inhibits mammalian elastases.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Protease inhibitor I15 (antistasin) family

Tissue Specificity: Not found in the saliva, but in the body tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P46443

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A