Recombinant Helicobacter pylori Urease subunit alpha (ureA) | CSB-EP320452HUV

Recombinant Helicobacter pylori Urease subunit alpha (ureA) | CSB-EP320452HUV | Cusabio

Alternative Name(s): Urea amidohydrolase subunit alpha

Gene Names: ureA

Research Areas: Others

Organism: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

AA Sequence: MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-238aa

Sequence Info: Full Length

MW: 30.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach.

Reference: Identification of the urease operon in Helicobacter pylori and its control by mRNA decay in response to pH.Akada J.K., Shirai M., Takeuchi H., Tsuda M., Nakazawa T.Mol. Microbiol. 36:1071-1084(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Urease gamma subunit family; Urease beta subunit family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P14916

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A