Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1 | CSB-EP838597GGS

(No reviews yet) Write a Review
SKU:
CSB-EP838597GGS
Availability:
3 - 7 Working Days
$422.40 - $2,042.40

Description

Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1 | CSB-EP838597GGS | Cusabio

Alternative Name(s): Calobin I (Fibrinogen-clotting enzyme) (Snake venom serine protease) (SVSP) (SVTLE)

Gene Names: N/A

Research Areas: Others

Organism: Gloydius ussuriensis (Ussuri mamushi) (Gloydius blomhoffii ussuriensis)

AA Sequence: VIGGDECNINEHRFLVALYNSRSRTLFCGGTLINQEWVLTAAHCERKNFRIKLGIHSKKVPNEDEQTRVPKEKFFCLSSKNYTLWDKDIMLIRLDSPVSNSEHIAPLSLPSSPPSVGSVCRIMGWGRISPTKETYPDVPHCANINLLEYEMCRAPYPEFGLPATSRTLCAGILEGGKDTCRGDSGGPLICNGQFQGIASWGDDPCAQPHKPAAYTKVFDHLDWIQSIIAGNTDASCPP

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 25-262aa

Sequence Info: Full Length of Mature Protein

MW: 33.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Thrombin-like snake venom serine protease. Has a coagulant activity. Acts on alpha-chains of fibrinogen generating fibrinopeptide A.

Reference: "Purification and molecular cloning of calobin, a thrombin-like enzyme from Agkistrodon caliginosus (Korean viper)." Hahn B.S., Yang K.Y., Park E.M., Chang I.M., Kim Y.S. J. Biochem. 119:835-843(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q91053

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose