Cusabio Virus & Bacteria Recombinants
Recombinant Geobacillus stearothermophilus Gellan lyase, partial | CSB-YP308328GFM
- SKU:
- CSB-YP308328GFM
- Availability:
- 25 - 35 Working Days
Description
Recombinant Geobacillus stearothermophilus Gellan lyase, partial | CSB-YP308328GFM | Cusabio
Alternative Name(s): Gellan lyase; EC 4.2.2.25; Fragments
Gene Names: N/A
Research Areas: Others
Organism: Geobacillus stearothermophilus (Bacillus stearothermophilus)
AA Sequence: LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-204aa
Sequence Info: Partial
MW: 22.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan.
Reference: Primary structure analysis of a purified thermostable gellan lyase produced by Bulgarian geothermal spring inhabitant Geobacillus stearothermophilus 98.Atanassova M., Rodriguez-Alonso P., Garabal J.I., Derekova A., Terziiska A., Mandeva R., Kambourova M.Eur. J. Biochem. 0:0-0(2008)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan.
Involvement in disease:
Subcellular Location: Secreted
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P85513
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A