Recombinant Gadus morhua subsp. callarias Parvalbumin beta | CSB-EP365766GAA

(No reviews yet) Write a Review
SKU:
CSB-EP365766GAA
Availability:
3 - 7 Working Days
  • Recombinant Gadus morhua subsp. callarias Parvalbumin beta
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Gadus morhua subsp. callarias Parvalbumin beta | CSB-EP365766GAA | Cusabio

Alternative Name(s): Parvalbumin beta; Allergen Gad c I; Allergen M; allergen Gad c 1

Gene Names: N/A

Research Areas: Others

Organism: Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias)

AA Sequence: AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-113aa

Sequence Info: Full Length

MW: 16.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.

Reference: The primary structure of allergen M from cod.Elsayed S., Bennich H.Scand. J. Immunol. 4:203-208(1975)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.

Involvement in disease:

Subcellular Location:

Protein Families: Parvalbumin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02622

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose