Cusabio Escherichia coli Recombinants
Recombinant Escherichia coli Type-1 fimbrial protein, A chain (fimA) | CSB-EP361210ENV
- SKU:
- CSB-EP361210ENV
- Availability:
- 3 - 7 Working Days
Description
Recombinant Escherichia coli Type-1 fimbrial protein, A chain (fimA) | CSB-EP361210ENV | Cusabio
Alternative Name(s): Type-1A pilin
Gene Names: fimA
Research Areas: Others
Organism: Escherichia coli (strain K12)
AA Sequence: AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 24-182aa
Sequence Info: Full Length of Mature Protein
MW: 31.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs
Reference: "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes."Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.
Involvement in disease:
Subcellular Location: Fimbrium
Protein Families: Fimbrial protein family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P04128
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A