Cusabio Escherichia coli Recombinants
Recombinant Escherichia coli Transposase insE for insertion sequence IS3A (insE1) | CSB-EP317177ENV
- SKU:
- CSB-EP317177ENV
- Availability:
- 13 - 23 Working Days
Description
Recombinant Escherichia coli Transposase insE for insertion sequence IS3A (insE1) | CSB-EP317177ENV | Cusabio
Alternative Name(s): insE1; b0298; JW5036; Transposase InsE for insertion sequence IS3A
Gene Names: insE1
Research Areas: Others
Organism: Escherichia coli (strain K12)
AA Sequence: MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-99aa
Sequence Info: Full Length
MW: 15.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Involved in the transposition of the insertion sequence IS3.
Reference: "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P0CF66
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A