Recombinant Escherichia coli Outer membrane protein C (ompC) | CSB-EP356994ENVe1

Recombinant Escherichia coli Outer membrane protein C (ompC) | CSB-EP356994ENVe1 | Cusabio

Alternative Name(s): Outer membrane protein 1BPorin OmpC

Gene Names: ompC

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Source: E.coli

Tag Info: Tag-Free

Expression Region: 22-367aa

Sequence Info: Full Length of Mature Protein

MW: 38.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Forms pores that allow passive diffusion of small molecules across the outer mbrane.

Reference: Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Forms pores that allow passive diffusion of small molecules across the outer membrane.

Involvement in disease:

Subcellular Location: Cell outer membrane, Multi-pass membrane protein

Protein Families: Gram-negative porin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P06996

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A