Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB) | CSB-EP359247ENVa1

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB) | CSB-EP359247ENVa1 | Cusabio

Alternative Name(s): 3-oxoacyl-[acyl-carrier-protein] synthase I Beta-ketoacyl-ACP synthase I

Gene Names: fabB

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-406aa

Sequence Info: Full Length

MW: 49.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Specific for elongation from C-10 to unsaturated C-16 and C-18 fatty acids.

Reference: "Role of Escherichia coli beta-ketoacyl-ACP synthase I in unsaturated fatty acid synthesis." Siggaard-Andersen M. Carlsberg Res. Commun. 53:371-379(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Specific for elongation from C-10 to unsaturated C-16 and C-18 fatty acids.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Beta-ketoacyl-ACP synthases family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A953

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A