Recombinant Epstein-Barr virus Small capsomere-interacting protein (SCP), partial | CSB-EP321237EFA(A4)

(No reviews yet) Write a Review
SKU:
CSB-EP321237EFA(A4)
Availability:
13 - 23 Working Days
€352.00 - €1,702.00

Description

Recombinant Epstein-Barr virus Small capsomere-interacting protein (SCP), partial | CSB-EP321237EFA(A4) | Cusabio

Alternative Name(s): SCP; BFRF3; Small capsomere-interacting protein

Gene Names: BFRF3

Research Areas: Others

Organism: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

AA Sequence: NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 31-176aa

Sequence Info: Partial

MW: 30.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: DNA sequence and expression of the B95-8 Epstein-Barr virus genome.Baer R., Bankier A.T., Biggin M.D., Deininger P.L., Farrell P.J., Gibson T.J., Hatfull G., Hudson G.S., Satchwell S.C., Seguin C., Tuffnell P.S., Barrell B.G.Nature 310:207-211(1984)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Involvement in disease:

Subcellular Location: Virion, Host nucleus

Protein Families: Herpesviridae small capsomere-interacting protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P14348

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose