Recombinant Enterobacteria phage T4 Double-stranded DNA-binding protein (dsbA) | CSB-EP321092EDZ

(No reviews yet) Write a Review
SKU:
CSB-EP321092EDZ
Availability:
3 - 7 Working Days
  • Recombinant Enterobacteria phage T4 Double-stranded DNA-binding protein (dsbA)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP321092EDZ could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) dsbA.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP321092EDZ could indicate that this peptide derived from E.coli-expressed
€352.00 - €1,702.00

Description

Recombinant Enterobacteria phage T4 Double-stranded DNA-binding protein (dsbA) | CSB-EP321092EDZ | Cusabio

Alternative Name(s): DsDNA-binding protein A (rpbB)

Gene Names: dsbA

Research Areas: Cell Biology

Organism: Enterobacteria phage T4 (Bacteriophage T4)

AA Sequence: MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-89aa

Sequence Info: Full Length

MW: 17.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions.

Reference: "Overexpression and structural characterization of the phage T4 protein DsbA." Sieber P., Lindemann A., Boehm M., Seidel G., Herzing U., van der Heusen P., Muller R., Ruger W., Jaenicke R., Rosch P. Biol. Chem. 379:51-58(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P13320

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose