Recombinant Enterobacteria phage lambda Host-nuclease inhibitor protein gam (gam) | CSB-EP356122ECW

Recombinant Enterobacteria phage lambda Host-nuclease inhibitor protein gam (gam) | CSB-EP356122ECW | Cusabio

Alternative Name(s): gamma

Gene Names: gam

Research Areas: Immunology

Organism: Escherichia phage lambda (Bacteriophage lambda)

AA Sequence: MDINTETEIKQKHSLTPFPVFLISPAFRGRYFHSYFRSSAMNAYYIQDRLEAQSWARHYQQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-138aa

Sequence Info: Full Length

MW: 23.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Binds to host RecBCD nuclease and inhibits it thereby protecting the viral DNA against recBCD mediated degradation.

Reference: "The crystal structure of lambda-Gam protein suggests a model for RecBCD inhibition." Court R., Cook N., Saikrishnan K., Wigley D. J. Mol. Biol. 371:25-33(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P03702

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A