Cusabio Drosophila melanogaster Recombinants
Recombinant Drosophila melanogaster Partner of bursicon (pburs) | CSB-YP893290DLU
- SKU:
- CSB-YP893290DLU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Drosophila melanogaster Partner of bursicon (pburs) | CSB-YP893290DLU | Cusabio
Alternative Name(s): Bursicon subunit beta
Gene Names: pburs
Research Areas: Others
Organism: Drosophila melanogaster (Fruit fly)
AA Sequence: LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 21-141aa
Sequence Info: Full Length of Mature Protein
MW: 15.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
Reference: Drosophila molting neurohormone bursicon is a heterodimer and the natural agonist of the orphan receptor DLGR2.Mendive F.M., Van Loy T., Claeysen S., Poels J., Williamson M., Hauser F., Grimmelikhuijzen C.J.P., Vassart G., Vanden Broeck J.J.M.FEBS Lett. 579:2171-2176(2005)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
Involvement in disease:
Subcellular Location: Secreted
Protein Families:
Tissue Specificity: Coexpressed with CCAP in most CCAP-specific neurons. Coexpressed with Burs in 4 bilateral neurons in thoracic and abdominal neuromeres of the ventral nervous system.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9VJS7
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A