Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1) | CSB-EP022397DIL

Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1) | CSB-EP022397DIL | Cusabio

Alternative Name(s): sod1; cuzn; Superoxide dismutase [Cu-Zn]; EC 1.15.1.1

Gene Names: sod1

Research Areas: Signal Transduction

Organism: Danio rerio (Zebrafish) (Brachydanio rerio)

AA Sequence: MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-154aa

Sequence Info: Full Length

MW: 37.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Reference: "Comparative effects of dietary methylmercury on gene expression in liver, skeletal muscle, and brain of the zebrafish (Danio rerio)." Gonzalez P., Dominique Y., Massabuau J.C., Boudou A., Bourdineaud J.P. Environ. Sci. Technol. 39:3972-3980(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families: Cu-Zn superoxide dismutase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O73872

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A