Recombinant Danio rerio Metallothionein-1 (mt) | CSB-EP344821DIL

Recombinant Danio rerio Metallothionein-1 (mt) | CSB-EP344821DIL | Cusabio

Alternative Name(s): mt; mt1; Metallothionein-1; MT-1

Gene Names: mt

Research Areas: Others

Organism: Danio rerio (Zebrafish) (Brachydanio rerio)

AA Sequence: MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-60aa

Sequence Info: Full Length

MW: 22 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals.

Reference: The use of metallothionein genes for determining the phylogenetic and evolutionary relationship between extant teleosts.Kille P., Olsson P.-E.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals.

Involvement in disease:

Subcellular Location:

Protein Families: Metallothionein superfamily, Type 1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P52722

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A