Recombinant Cyriopagopus schmidti Tau-theraphotoxin-Hs1a | CSB-EP316743DRU

(No reviews yet) Write a Review
SKU:
CSB-EP316743DRU
Availability:
13 - 23 Working Days
€352.00 - €1,702.00

Description

Recombinant Cyriopagopus schmidti Tau-theraphotoxin-Hs1a | CSB-EP316743DRU | Cusabio

Alternative Name(s): Double-knot toxin (DkTx) (Tau-TRTX-Hs1a)

Gene Names: N/A

Research Areas: Others

Organism: Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)

AA Sequence: DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYRGRND

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-79aa

Sequence Info: Full Length

MW: 13.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Selectively activates the heat-activated TRPV1 channel. It binds to TRPV1 in an open state-dependent manner, trapping it there to produce irreversible currents. It binds to the outer edge of the external pore of TRPV1 in a counterclockwise configuration, using a limited protein-protein interface and inserting hydrophobic residues into the bilayer. It also partitions naturally into membranes, with the two lobes exhibiting opposing energetics for membrane partitioning and channel activation. In addition, the toxin disrupts a cluster of hydrophobic residues behind the selectivity filter that are critical for channel activation.

Reference: "TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action." Gao Y., Cao E., Julius D., Cheng Y. Nature 534:347-351(2016)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0CH43

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose